PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00003g04333.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 402aa    MW: 45510.4 Da    PI: 5.2859
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00003g04333.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.54.6e-31220274155
                   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                               k+r+rW+++LH+rFve+v++LGG++kAtPk+il+lm+ +gLt+ hvkSHLQkYR+
  Peaxi162Scf00003g04333.1 220 KTRIRWNEDLHDRFVECVNRLGGADKATPKAILKLMDSEGLTIFHVKSHLQKYRT 274
                               68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-27218275IPR009057Homeodomain-like
SuperFamilySSF466899.5E-16219274IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-23220275IPR006447Myb domain, plants
PfamPF002492.8E-7224273IPR001005SANT/Myb domain
PfamPF143791.3E-20304351IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MSIPQNYEFA SEYNLEFQQI DQQKASPYVG FCFQPETSAQ TGCLVDSSSR NIISRIESPP  60
SAFFATERYL GLTQYEYQDN TYQLSKNHDP QQCGNGFLVD SPAQARADPD FSNVSVPSFI  120
RSQFSSSQPL SPEGPYGNTY CNLSEKERIL LLKSRLLKDF DTSNGQPSMP FLGNQDYSLS  180
QNLCHFNLVH TRQQSEVPSG SQSTYNFNNS GCSGGSLSNK TRIRWNEDLH DRFVECVNRL  240
GGADKATPKA ILKLMDSEGL TIFHVKSHLQ KYRTAKSIPE SIEGKSDKID SPNDVTQIDS  300
KTGMQIKEAL HMQLEVQKRL HEQLEIQRKL QMRIEEQGKQ LKELFDQQQK TTRSLLETQT  360
TNISSPNDPF TLHEDEVFVV ESFDDTHFPS QISYNGTTTT SV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016483648.10.0PREDICTED: uncharacterized protein LOC107804295 isoform X2
TrEMBLM1ATC90.0M1ATC9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000297580.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24912458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.13e-71G2-like family protein